Anti LGALS9 pAb (ATL-HPA047218 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047218-25

• 
• 

Protein Description: lectin, galactoside-binding, soluble, 9
Gene Name: LGALS9
Alternative Gene Name: LGALS9A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001123: 77%, ENSRNOG00000012681: 80%
Entrez Gene ID: 3965
Uniprot ID: O00182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTIN
• Gene Sequence: RFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTIN
• Gene ID - Mouse: ENSMUSG00000001123
• Gene ID - Rat: ENSRNOG00000012681
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.