Anti LGALS14 pAb (ATL-HPA065180)

Atlas Antibodies

SKU: ATL-HPA065180-25

• 

Product Description

Protein Description: galectin 14
Gene Name: LGALS14
Alternative Gene Name: CLC2, PPL13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001123: 32%, ENSRNOG00000012681: 32%
Entrez Gene ID: 56891
Uniprot ID: Q8TCE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPF
• Gene Sequence: QFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPF
• Gene ID - Mouse: ENSMUSG00000001123
• Gene ID - Rat: ENSRNOG00000012681
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links