Anti LGALS14 pAb (ATL-HPA065180)
Atlas Antibodies
- SKU:
- ATL-HPA065180-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: galectin 14
Gene Name: LGALS14
Alternative Gene Name: CLC2, PPL13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001123: 32%, ENSRNOG00000012681: 32%
Entrez Gene ID: 56891
Uniprot ID: Q8TCE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LGALS14
Alternative Gene Name: CLC2, PPL13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001123: 32%, ENSRNOG00000012681: 32%
Entrez Gene ID: 56891
Uniprot ID: Q8TCE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPF |
Gene Sequence | QFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPF |
Gene ID - Mouse | ENSMUSG00000001123 |
Gene ID - Rat | ENSRNOG00000012681 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti LGALS14 pAb (ATL-HPA065180) | |
Datasheet | Anti LGALS14 pAb (ATL-HPA065180) Datasheet (External Link) |
Vendor Page | Anti LGALS14 pAb (ATL-HPA065180) at Atlas Antibodies |
Documents & Links for Anti LGALS14 pAb (ATL-HPA065180) | |
Datasheet | Anti LGALS14 pAb (ATL-HPA065180) Datasheet (External Link) |
Vendor Page | Anti LGALS14 pAb (ATL-HPA065180) |