Protein Description: galectin 14
Gene Name: LGALS14
Alternative Gene Name: CLC2, PPL13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001123: 32%, ENSRNOG00000012681: 32%
Entrez Gene ID: 56891
Uniprot ID: Q8TCE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LGALS14
Alternative Gene Name: CLC2, PPL13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001123: 32%, ENSRNOG00000012681: 32%
Entrez Gene ID: 56891
Uniprot ID: Q8TCE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPF |
| Documents & Links for Anti LGALS14 pAb (ATL-HPA065180) | |
| Datasheet | Anti LGALS14 pAb (ATL-HPA065180) Datasheet (External Link) |
| Vendor Page | Anti LGALS14 pAb (ATL-HPA065180) at Atlas |
| Documents & Links for Anti LGALS14 pAb (ATL-HPA065180) | |
| Datasheet | Anti LGALS14 pAb (ATL-HPA065180) Datasheet (External Link) |
| Vendor Page | Anti LGALS14 pAb (ATL-HPA065180) |