Anti LENG9 pAb (ATL-HPA051671)

Atlas Antibodies

SKU:
ATL-HPA051671-25
  • Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in a subset of tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: leukocyte receptor cluster (LRC) member 9
Gene Name: LENG9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043432: 70%, ENSRNOG00000018621: 69%
Entrez Gene ID: 94059
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NFLVPSQNLHLTLALLRLAGAGEEAAAIGALRRALLAPGLNAPPRLSFRKLVLLGPHVLCAPPSPTLESMAQVLSQRLEAEGLSTLQSPGQLHPHLTVAKVPHGSQV
Gene Sequence NFLVPSQNLHLTLALLRLAGAGEEAAAIGALRRALLAPGLNAPPRLSFRKLVLLGPHVLCAPPSPTLESMAQVLSQRLEAEGLSTLQSPGQLHPHLTVAKVPHGSQV
Gene ID - Mouse ENSMUSG00000043432
Gene ID - Rat ENSRNOG00000018621
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LENG9 pAb (ATL-HPA051671)
Datasheet Anti LENG9 pAb (ATL-HPA051671) Datasheet (External Link)
Vendor Page Anti LENG9 pAb (ATL-HPA051671) at Atlas Antibodies

Documents & Links for Anti LENG9 pAb (ATL-HPA051671)
Datasheet Anti LENG9 pAb (ATL-HPA051671) Datasheet (External Link)
Vendor Page Anti LENG9 pAb (ATL-HPA051671)