Anti LEKR1 pAb (ATL-HPA047774)

Atlas Antibodies

SKU: ATL-HPA047774-25

• 

Protein Description: leucine, glutamate and lysine rich 1
Gene Name: LEKR1
Alternative Gene Name: FLJ16641
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074579: 77%, ENSRNOG00000031247: 74%
Entrez Gene ID: 389170
Uniprot ID: Q6ZMV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDHHIPMHALPEEIQKMLPEEKVCKYCGVSYLILHEFKAMEEKVKAMEKEMKFYQGSVDREKRLQEKLHSLSQELEQYKIDNKSKTERIYDVG
• Gene Sequence: MDHHIPMHALPEEIQKMLPEEKVCKYCGVSYLILHEFKAMEEKVKAMEKEMKFYQGSVDREKRLQEKLHSLSQELEQYKIDNKSKTERIYDVG
• Gene ID - Mouse: ENSMUSG00000074579
• Gene ID - Rat: ENSRNOG00000031247
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.