Protein Description: low density lipoprotein receptor class A domain containing 4
Gene Name: LDLRAD4
Alternative Gene Name: C18orf1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024544: 81%, ENSRNOG00000016879: 81%
Entrez Gene ID: 753
Uniprot ID: O15165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LDLRAD4
Alternative Gene Name: C18orf1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024544: 81%, ENSRNOG00000016879: 81%
Entrez Gene ID: 753
Uniprot ID: O15165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HYKVSTRSFINRPNQSRRREDGLPQEGCLWPSDSAAPRLGASEIMHAPRSRDRFTAPSFIQRDRFSRFQ |
| Documents & Links for Anti LDLRAD4 pAb (ATL-HPA065246) | |
| Datasheet | Anti LDLRAD4 pAb (ATL-HPA065246) Datasheet (External Link) |
| Vendor Page | Anti LDLRAD4 pAb (ATL-HPA065246) at Atlas |
| Documents & Links for Anti LDLRAD4 pAb (ATL-HPA065246) | |
| Datasheet | Anti LDLRAD4 pAb (ATL-HPA065246) Datasheet (External Link) |
| Vendor Page | Anti LDLRAD4 pAb (ATL-HPA065246) |