Anti LDLRAD4 pAb (ATL-HPA054556)

Atlas Antibodies

SKU:
ATL-HPA054556-25
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: low density lipoprotein receptor class A domain containing 4
Gene Name: LDLRAD4
Alternative Gene Name: C18orf1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024544: 81%, ENSRNOG00000016879: 81%
Entrez Gene ID: 753
Uniprot ID: O15165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HYKVSTRSFINRPNQSRRREDGLPQEGCLWPSDSAAPRLGASEIMHAPRSRDRFTAPSFIQRDRFSRFQ
Gene Sequence HYKVSTRSFINRPNQSRRREDGLPQEGCLWPSDSAAPRLGASEIMHAPRSRDRFTAPSFIQRDRFSRFQ
Gene ID - Mouse ENSMUSG00000024544
Gene ID - Rat ENSRNOG00000016879
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LDLRAD4 pAb (ATL-HPA054556)
Datasheet Anti LDLRAD4 pAb (ATL-HPA054556) Datasheet (External Link)
Vendor Page Anti LDLRAD4 pAb (ATL-HPA054556) at Atlas Antibodies

Documents & Links for Anti LDLRAD4 pAb (ATL-HPA054556)
Datasheet Anti LDLRAD4 pAb (ATL-HPA054556) Datasheet (External Link)
Vendor Page Anti LDLRAD4 pAb (ATL-HPA054556)