Anti LDLRAD1 pAb (ATL-HPA052489 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052489-25

• 

Protein Description: low density lipoprotein receptor class A domain containing 1
Gene Name: LDLRAD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070877: 74%, ENSRNOG00000037795: 68%
Entrez Gene ID: 388633
Uniprot ID: Q5T700
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAQACITLTNRTGFLCHDQRSCIPASGVCDGVRTCTHGEDEDESLCRDVPQSLPHFLVAHCGDPASWI
• Gene Sequence: GAQACITLTNRTGFLCHDQRSCIPASGVCDGVRTCTHGEDEDESLCRDVPQSLPHFLVAHCGDPASWI
• Gene ID - Mouse: ENSMUSG00000070877
• Gene ID - Rat: ENSRNOG00000037795
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.