Anti LDHAL6B pAb (ATL-HPA053962 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053962-25

• 

Protein Description: lactate dehydrogenase A-like 6B
Gene Name: LDHAL6B
Alternative Gene Name: LDH6B, LDHAL6, LDHL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000101959: 48%, ENSRNOG00000010775: 30%
Entrez Gene ID: 92483
Uniprot ID: Q9BYZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVPVVRASQRVSSVGANFLCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIERFTSEKPV
• Gene Sequence: TVPVVRASQRVSSVGANFLCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIERFTSEKPV
• Gene ID - Mouse: ENSMUSG00000101959
• Gene ID - Rat: ENSRNOG00000010775
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.