Anti LCORL pAb (ATL-HPA060033)

Atlas Antibodies

SKU:
ATL-HPA060033-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ligand dependent nuclear receptor corepressor-like
Gene Name: LCORL
Alternative Gene Name: FLJ30696, MLR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015882: 97%, ENSRNOG00000003787: 95%
Entrez Gene ID: 254251
Uniprot ID: Q8N3X6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DCIPSLDSSQSTPTEELSSQGQSNTDKIECQAENYLNALFRKKDLPQNCDPNIPLVAQELMKKMIRQFAIEYISKSGKTQENRNGSI
Gene Sequence DCIPSLDSSQSTPTEELSSQGQSNTDKIECQAENYLNALFRKKDLPQNCDPNIPLVAQELMKKMIRQFAIEYISKSGKTQENRNGSI
Gene ID - Mouse ENSMUSG00000015882
Gene ID - Rat ENSRNOG00000003787
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LCORL pAb (ATL-HPA060033)
Datasheet Anti LCORL pAb (ATL-HPA060033) Datasheet (External Link)
Vendor Page Anti LCORL pAb (ATL-HPA060033) at Atlas Antibodies

Documents & Links for Anti LCORL pAb (ATL-HPA060033)
Datasheet Anti LCORL pAb (ATL-HPA060033) Datasheet (External Link)
Vendor Page Anti LCORL pAb (ATL-HPA060033)