Anti LCN15 pAb (ATL-HPA060584 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA060584-25
  • Immunohistochemistry analysis in human duodenum and liver tissues using Anti-LCN15 antibody. Corresponding LCN15 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: lipocalin 15
Gene Name: LCN15
Alternative Gene Name: PRO6093, UNQ2541
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026936: 34%, ENSRNOG00000028701: 36%
Entrez Gene ID: 389812
Uniprot ID: Q6UWW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAVLYIYKELEGALSTMVQLYSRTQDVSPQALKAFQDFYPTLGLPEDMMVMLPQSDACNPESKE
Gene Sequence FAVLYIYKELEGALSTMVQLYSRTQDVSPQALKAFQDFYPTLGLPEDMMVMLPQSDACNPESKE
Gene ID - Mouse ENSMUSG00000026936
Gene ID - Rat ENSRNOG00000028701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LCN15 pAb (ATL-HPA060584 w/enhanced validation)
Datasheet Anti LCN15 pAb (ATL-HPA060584 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LCN15 pAb (ATL-HPA060584 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LCN15 pAb (ATL-HPA060584 w/enhanced validation)
Datasheet Anti LCN15 pAb (ATL-HPA060584 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LCN15 pAb (ATL-HPA060584 w/enhanced validation)