Anti LCMT2 pAb (ATL-HPA048176)

Atlas Antibodies

SKU:
ATL-HPA048176-100
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & vesicles.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: leucine carboxyl methyltransferase 2
Gene Name: LCMT2
Alternative Gene Name: KIAA0547, MGC9534, PPM2, TYW4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074890: 67%, ENSRNOG00000043002: 67%
Entrez Gene ID: 9836
Uniprot ID: O60294
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLVFPSSEAFPRVNPASPSGVFPASVVSSEGQVPNLKRYGHASVFLSPDVILSAGGFGEQEGRHCRVSQFHLLSRDCDSEWKGSQIGSCGTGVQWDGR
Gene Sequence TLVFPSSEAFPRVNPASPSGVFPASVVSSEGQVPNLKRYGHASVFLSPDVILSAGGFGEQEGRHCRVSQFHLLSRDCDSEWKGSQIGSCGTGVQWDGR
Gene ID - Mouse ENSMUSG00000074890
Gene ID - Rat ENSRNOG00000043002
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LCMT2 pAb (ATL-HPA048176)
Datasheet Anti LCMT2 pAb (ATL-HPA048176) Datasheet (External Link)
Vendor Page Anti LCMT2 pAb (ATL-HPA048176) at Atlas Antibodies

Documents & Links for Anti LCMT2 pAb (ATL-HPA048176)
Datasheet Anti LCMT2 pAb (ATL-HPA048176) Datasheet (External Link)
Vendor Page Anti LCMT2 pAb (ATL-HPA048176)