Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA046376-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: late cornified envelope 6A
Gene Name: LCE6A
Alternative Gene Name: C1orf44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000086848: 45%, ENSRNOG00000055370: 46%
Entrez Gene ID: 448835
Uniprot ID: A0A183
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD
Gene Sequence MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD
Gene ID - Mouse ENSMUSG00000086848
Gene ID - Rat ENSRNOG00000055370
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation)
Datasheet Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation)
Datasheet Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation)
Citations for Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation) – 1 Found
Boutrand, Laetitia-Barbollat; Thépot, Amélie; Muther, Charlotte; Boher, Aurélie; Robic, Julie; Guéré, Christelle; Vié, Katell; Damour, Odile; Lamartine, Jérôme. Repeated short climatic change affects the epidermal differentiation program and leads to matrix remodeling in a human organotypic skin model. Clinical, Cosmetic And Investigational Dermatology. 10( 28243135):43-50.  PubMed