Anti LARP6 pAb (ATL-HPA049029)

Atlas Antibodies

SKU: ATL-HPA049029-25

• 

Protein Description: La ribonucleoprotein domain family, member 6
Gene Name: LARP6
Alternative Gene Name: acheron, FLJ11196
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034839: 90%, ENSRNOG00000012438: 86%
Entrez Gene ID: 55323
Uniprot ID: Q9BRS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NMKAVLIGMKPPKKKPAKDKNHDEEPTASIHLNKSLNKRVEELQYMGDESSANSSSDPESNPTSPMAGRRHAATNKLSPSGHQNLFLSPNA
• Gene Sequence: NMKAVLIGMKPPKKKPAKDKNHDEEPTASIHLNKSLNKRVEELQYMGDESSANSSSDPESNPTSPMAGRRHAATNKLSPSGHQNLFLSPNA
• Gene ID - Mouse: ENSMUSG00000034839
• Gene ID - Rat: ENSRNOG00000012438
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LARP6 pAb (ATL-HPA049029) – 1 Found

Dermit, Maria; Dodel, Martin; Lee, Flora C Y; Azman, Muhammad S; Schwenzer, Hagen; Jones, J Louise; Blagden, Sarah P; Ule, Jernej; Mardakheh, Faraz K. Subcellular mRNA Localization Regulates Ribosome Biogenesis in Migrating Cells. Developmental Cell. 2020;55(3):298-313.e10.