Anti LAPTM5 pAb (ATL-HPA051293)
Atlas Antibodies
- SKU:
- ATL-HPA051293-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LAPTM5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028581: 69%, ENSRNOG00000011054: 66%
Entrez Gene ID: 7805
Uniprot ID: Q13571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTP |
Gene Sequence | IKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTP |
Gene ID - Mouse | ENSMUSG00000028581 |
Gene ID - Rat | ENSRNOG00000011054 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LAPTM5 pAb (ATL-HPA051293) | |
Datasheet | Anti LAPTM5 pAb (ATL-HPA051293) Datasheet (External Link) |
Vendor Page | Anti LAPTM5 pAb (ATL-HPA051293) at Atlas Antibodies |
Documents & Links for Anti LAPTM5 pAb (ATL-HPA051293) | |
Datasheet | Anti LAPTM5 pAb (ATL-HPA051293) Datasheet (External Link) |
Vendor Page | Anti LAPTM5 pAb (ATL-HPA051293) |