Anti LAMP3 pAb (ATL-HPA051467 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051467-25

• 
• 

Protein Description: lysosomal-associated membrane protein 3
Gene Name: LAMP3
Alternative Gene Name: CD208, DC-LAMP, DCLAMP, LAMP, TSC403
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041247: 52%, ENSRNOG00000022792: 46%
Entrez Gene ID: 27074
Uniprot ID: Q9UQV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNAT
• Gene Sequence: SIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNAT
• Gene ID - Mouse: ENSMUSG00000041247
• Gene ID - Rat: ENSRNOG00000022792
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LAMP3 pAb (ATL-HPA051467 w/enhanced validation) – 1 Found

Delvecchio, Francesca R; Fincham, Rachel E A; Spear, Sarah; Clear, Andrew; Roy-Luzarraga, Marina; Balkwill, Frances R; Gribben, John G; Bombardieri, Michele; Hodivala-Dilke, Kairbaan; Capasso, Melania; Kocher, Hemant M. Pancreatic Cancer Chemotherapy Is Potentiated by Induction of Tertiary Lymphoid Structures in Mice. Cellular And Molecular Gastroenterology And Hepatology. 12(5):1543-1565.