Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA040150-25
  • Immunohistochemical staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and lACC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407147).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: laccase (multicopper oxidoreductase) domain containing 1
Gene Name: LACC1
Alternative Gene Name: C13orf31, FLJ38725
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044350: 66%, ENSRNOG00000022094: 59%
Entrez Gene ID: 144811
Uniprot ID: Q8IV20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLSALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVI
Gene Sequence FGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLSALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVI
Gene ID - Mouse ENSMUSG00000044350
Gene ID - Rat ENSRNOG00000022094
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation)
Datasheet Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation)
Datasheet Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation)



Citations for Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation) – 2 Found
Drobin, Kimi; Assadi, Ghazaleh; Hong, Mun-Gwan; Andersson, Eni; Fredolini, Claudia; Forsström, Björn; Reznichenko, Anna; Akhter, Tahmina; Ek, Weronica E; Bonfiglio, Ferdinando; Hansen, Mark Berner; Sandberg, Kristian; Greco, Dario; Repsilber, Dirk; Schwenk, Jochen M; D'Amato, Mauro; Halfvarson, Jonas. Targeted Analysis of Serum Proteins Encoded at Known Inflammatory Bowel Disease Risk Loci. Inflammatory Bowel Diseases. 2019;25(2):306-316.  PubMed
Omarjee, Ommar; Mathieu, Anne-Laure; Quiniou, Gaëlle; Moreews, Marion; Ainouze, Michelle; Frachette, Cécile; Melki, Isabelle; Dumaine, Cécile; Gerfaud-Valentin, Mathieu; Duquesne, Agnès; Kallinich, Tilmann; Tahir Turanli, Eda; Malcus, Christophe; Viel, Sébastien; Pescarmona, Rémi; Georgin-Lavialle, Sophie; Jamilloux, Yvan; Larbre, Jean-Paul; Sarrabay, Guillaume; Magnotti, Flora; Rice, Gillian I; Bleicher, Francoise; Reboulet, Jonathan; Merabet, Samir; Henry, Thomas; Crow, Yanick J; Faure, Mathias; Walzer, Thierry; Belot, Alexandre. LACC1 deficiency links juvenile arthritis with autophagy and metabolism in macrophages. The Journal Of Experimental Medicine. 2021;218(3)  PubMed