Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA040150-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LACC1
Alternative Gene Name: C13orf31, FLJ38725
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044350: 66%, ENSRNOG00000022094: 59%
Entrez Gene ID: 144811
Uniprot ID: Q8IV20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLSALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVI |
Gene Sequence | FGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLSALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVI |
Gene ID - Mouse | ENSMUSG00000044350 |
Gene ID - Rat | ENSRNOG00000022094 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation) | |
Datasheet | Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation) | |
Datasheet | Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation) |
Citations for Anti LACC1 pAb (ATL-HPA040150 w/enhanced validation) – 2 Found |
Drobin, Kimi; Assadi, Ghazaleh; Hong, Mun-Gwan; Andersson, Eni; Fredolini, Claudia; Forsström, Björn; Reznichenko, Anna; Akhter, Tahmina; Ek, Weronica E; Bonfiglio, Ferdinando; Hansen, Mark Berner; Sandberg, Kristian; Greco, Dario; Repsilber, Dirk; Schwenk, Jochen M; D'Amato, Mauro; Halfvarson, Jonas. Targeted Analysis of Serum Proteins Encoded at Known Inflammatory Bowel Disease Risk Loci. Inflammatory Bowel Diseases. 2019;25(2):306-316. PubMed |
Omarjee, Ommar; Mathieu, Anne-Laure; Quiniou, Gaëlle; Moreews, Marion; Ainouze, Michelle; Frachette, Cécile; Melki, Isabelle; Dumaine, Cécile; Gerfaud-Valentin, Mathieu; Duquesne, Agnès; Kallinich, Tilmann; Tahir Turanli, Eda; Malcus, Christophe; Viel, Sébastien; Pescarmona, Rémi; Georgin-Lavialle, Sophie; Jamilloux, Yvan; Larbre, Jean-Paul; Sarrabay, Guillaume; Magnotti, Flora; Rice, Gillian I; Bleicher, Francoise; Reboulet, Jonathan; Merabet, Samir; Henry, Thomas; Crow, Yanick J; Faure, Mathias; Walzer, Thierry; Belot, Alexandre. LACC1 deficiency links juvenile arthritis with autophagy and metabolism in macrophages. The Journal Of Experimental Medicine. 2021;218(3) PubMed |