Anti L3HYPDH pAb (ATL-HPA056694)

Atlas Antibodies

SKU:
ATL-HPA056694-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line U-87 MG
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: L-3-hydroxyproline dehydratase (trans-)
Gene Name: L3HYPDH
Alternative Gene Name: C14orf149, FLJ25436
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019718: 87%, ENSRNOG00000004503: 89%
Entrez Gene ID: 112849
Uniprot ID: Q96EM0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MESALAVPRLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDHVRRRLMFEPRGHRDMYGAVLVPSEL
Gene Sequence MESALAVPRLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDHVRRRLMFEPRGHRDMYGAVLVPSEL
Gene ID - Mouse ENSMUSG00000019718
Gene ID - Rat ENSRNOG00000004503
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti L3HYPDH pAb (ATL-HPA056694)
Datasheet Anti L3HYPDH pAb (ATL-HPA056694) Datasheet (External Link)
Vendor Page Anti L3HYPDH pAb (ATL-HPA056694) at Atlas Antibodies

Documents & Links for Anti L3HYPDH pAb (ATL-HPA056694)
Datasheet Anti L3HYPDH pAb (ATL-HPA056694) Datasheet (External Link)
Vendor Page Anti L3HYPDH pAb (ATL-HPA056694)