Anti KYAT1 pAb (ATL-HPA021177)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021177-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: KYAT1
Alternative Gene Name: CCBL1, GTK, KATI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039648: 81%, ENSRNOG00000016097: 80%
Entrez Gene ID: 883
Uniprot ID: Q16773
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVF |
| Gene Sequence | LVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVF |
| Gene ID - Mouse | ENSMUSG00000039648 |
| Gene ID - Rat | ENSRNOG00000016097 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KYAT1 pAb (ATL-HPA021177) | |
| Datasheet | Anti KYAT1 pAb (ATL-HPA021177) Datasheet (External Link) |
| Vendor Page | Anti KYAT1 pAb (ATL-HPA021177) at Atlas Antibodies |
| Documents & Links for Anti KYAT1 pAb (ATL-HPA021177) | |
| Datasheet | Anti KYAT1 pAb (ATL-HPA021177) Datasheet (External Link) |
| Vendor Page | Anti KYAT1 pAb (ATL-HPA021177) |
| Citations for Anti KYAT1 pAb (ATL-HPA021177) – 1 Found |
| van Steenbeek, Frank G; Van den Bossche, Lindsay; Grinwis, Guy C M; Kummeling, Anne; van Gils, Ingrid H M; Koerkamp, Marian J A Groot; van Leenen, Dik; Holstege, Frank C P; Penning, Louis C; Rothuizen, Jan; Leegwater, Peter A J; Spee, Bart. Aberrant gene expression in dogs with portosystemic shunts. Plos One. 8(2):e57662. PubMed |