Anti KRTCAP3 pAb (ATL-HPA047136 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047136-100

• 
• 

Protein Description: keratinocyte associated protein 3
Gene Name: KRTCAP3
Alternative Gene Name: KCP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029149: 67%, ENSRNOG00000047941: 67%
Entrez Gene ID: 200634
Uniprot ID: Q53RY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLRGVGPCRKDGLQGQLEEMTELESPKCKRQENEQLLDQNQEIRASQRSWV
• Gene Sequence: TLRGVGPCRKDGLQGQLEEMTELESPKCKRQENEQLLDQNQEIRASQRSWV
• Gene ID - Mouse: ENSMUSG00000029149
• Gene ID - Rat: ENSRNOG00000047941
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.