Protein Description: keratin associated protein 16-1
Gene Name: KRTAP16-1
Alternative Gene Name: KAP16.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078253: 61%, ENSRNOG00000061192: 62%
Entrez Gene ID: 100505753
Uniprot ID: A8MUX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KRTAP16-1
Alternative Gene Name: KAP16.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078253: 61%, ENSRNOG00000061192: 62%
Entrez Gene ID: 100505753
Uniprot ID: A8MUX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ACVTSYSCRPVYFRPSCTESDSCKRDCKKSTSSQLDCVDTTPCKVDVSEEAPCQPTEAKPISPTTR |
Documents & Links for Anti KRTAP16-1 pAb (ATL-HPA070954) | |
Datasheet | Anti KRTAP16-1 pAb (ATL-HPA070954) Datasheet (External Link) |
Vendor Page | Anti KRTAP16-1 pAb (ATL-HPA070954) at Atlas |
Documents & Links for Anti KRTAP16-1 pAb (ATL-HPA070954) | |
Datasheet | Anti KRTAP16-1 pAb (ATL-HPA070954) Datasheet (External Link) |
Vendor Page | Anti KRTAP16-1 pAb (ATL-HPA070954) |