Anti KRTAP11-1 pAb (ATL-HPA054008)

Atlas Antibodies

SKU:
ATL-HPA054008-25
  • Immunohistochemical staining of human skin shows moderate to strong cytoplasmic positivity in hair follicle.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: keratin associated protein 11-1
Gene Name: KRTAP11-1
Alternative Gene Name: KAP11.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091212: 82%, ENSRNOG00000027478: 79%
Entrez Gene ID: 337880
Uniprot ID: Q8IUC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QETCCEPTACQPTCYRRTSCVSNPCQVTCSRQTTCISNPCSTTYSRPLTFVSSGCQPLGGISSVCQPVGGISTVCQPVGGVS
Gene Sequence QETCCEPTACQPTCYRRTSCVSNPCQVTCSRQTTCISNPCSTTYSRPLTFVSSGCQPLGGISSVCQPVGGISTVCQPVGGVS
Gene ID - Mouse ENSMUSG00000091212
Gene ID - Rat ENSRNOG00000027478
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KRTAP11-1 pAb (ATL-HPA054008)
Datasheet Anti KRTAP11-1 pAb (ATL-HPA054008) Datasheet (External Link)
Vendor Page Anti KRTAP11-1 pAb (ATL-HPA054008) at Atlas Antibodies

Documents & Links for Anti KRTAP11-1 pAb (ATL-HPA054008)
Datasheet Anti KRTAP11-1 pAb (ATL-HPA054008) Datasheet (External Link)
Vendor Page Anti KRTAP11-1 pAb (ATL-HPA054008)