Anti KRT82 pAb (ATL-HPA058715 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA058715-25
  • Immunohistochemical staining of human colon, kidney, skin, hairy and testis using Anti-KRT82 antibody HPA058715 (A) shows similar protein distribution across tissues to independent antibody HPA067230 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: keratin 82
Gene Name: KRT82
Alternative Gene Name: Hb-2, KRTHB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049548: 66%, ENSRNOG00000033403: 71%
Entrez Gene ID: 3888
Uniprot ID: Q9NSB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLLSCGSGRKSSMTLGAG
Gene Sequence SSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLLSCGSGRKSSMTLGAG
Gene ID - Mouse ENSMUSG00000049548
Gene ID - Rat ENSRNOG00000033403
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KRT82 pAb (ATL-HPA058715 w/enhanced validation)
Datasheet Anti KRT82 pAb (ATL-HPA058715 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT82 pAb (ATL-HPA058715 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KRT82 pAb (ATL-HPA058715 w/enhanced validation)
Datasheet Anti KRT82 pAb (ATL-HPA058715 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT82 pAb (ATL-HPA058715 w/enhanced validation)