Protein Description: keratin 80, type II
Gene Name: KRT80
Alternative Gene Name: KB20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037185: 70%, ENSRNOG00000025994: 71%
Entrez Gene ID: 144501
Uniprot ID: Q6KB66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KRT80
Alternative Gene Name: KB20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037185: 70%, ENSRNOG00000025994: 71%
Entrez Gene ID: 144501
Uniprot ID: Q6KB66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LGPSIPSPTTHHCCQPQDLDAECLHRTELETKLKSLESFVELMKTIYEQELKDLAAQVKDVSVTVGMDSRCHIDLSGIVEEVKAQYDAV |
| Documents & Links for Anti KRT80 pAb (ATL-HPA077836) | |
| Datasheet | Anti KRT80 pAb (ATL-HPA077836) Datasheet (External Link) |
| Vendor Page | Anti KRT80 pAb (ATL-HPA077836) at Atlas |
| Documents & Links for Anti KRT80 pAb (ATL-HPA077836) | |
| Datasheet | Anti KRT80 pAb (ATL-HPA077836) Datasheet (External Link) |
| Vendor Page | Anti KRT80 pAb (ATL-HPA077836) |
| Citations for Anti KRT80 pAb (ATL-HPA077836) – 1 Found |
| Perone, Ylenia; Farrugia, Aaron J; Rodríguez-Meira, Alba; Győrffy, Balázs; Ion, Charlotte; Uggetti, Andrea; Chronopoulos, Antonios; Marrazzo, Pasquale; Faronato, Monica; Shousha, Sami; Davies, Claire; Steel, Jennifer H; Patel, Naina; Del Rio Hernandez, Armando; Coombes, Charles; Pruneri, Giancarlo; Lim, Adrian; Calvo, Fernando; Magnani, Luca. SREBP1 drives Keratin-80-dependent cytoskeletal changes and invasive behavior in endocrine-resistant ERα breast cancer. Nature Communications. 2019;10(1):2115. PubMed |