Anti KRT79 pAb (ATL-HPA059347 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA059347-25
  • Immunohistochemistry analysis in human skin and liver tissues using HPA059347 antibody. Corresponding KRT79 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: keratin 79
Gene Name: KRT79
Alternative Gene Name: K6L, KRT6L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061397: 75%, ENSRNOG00000009105: 47%
Entrez Gene ID: 338785
Uniprot ID: Q5XKE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGAHCGPGTGGFGS
Gene Sequence MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGAHCGPGTGGFGS
Gene ID - Mouse ENSMUSG00000061397
Gene ID - Rat ENSRNOG00000009105
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KRT79 pAb (ATL-HPA059347 w/enhanced validation)
Datasheet Anti KRT79 pAb (ATL-HPA059347 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT79 pAb (ATL-HPA059347 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KRT79 pAb (ATL-HPA059347 w/enhanced validation)
Datasheet Anti KRT79 pAb (ATL-HPA059347 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT79 pAb (ATL-HPA059347 w/enhanced validation)