Anti KRT222 pAb (ATL-HPA054586 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA054586-100
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in endocrine cells.
  • Immunofluorescent staining of human cell line A549 shows localization to vesicles.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and KRT222 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407599).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: keratin 222
Gene Name: KRT222
Alternative Gene Name: KA21, KRT222P, MGC45562
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035849: 79%, ENSRNOG00000010839: 75%
Entrez Gene ID: 125113
Uniprot ID: Q8N1A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YYGCIQGGKKDKKPTTSRVGFVLPSAIINEISFTTKVPQKYENENVETVTKQAILNGSIVKESTEAHGTIQ
Gene Sequence YYGCIQGGKKDKKPTTSRVGFVLPSAIINEISFTTKVPQKYENENVETVTKQAILNGSIVKESTEAHGTIQ
Gene ID - Mouse ENSMUSG00000035849
Gene ID - Rat ENSRNOG00000010839
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti KRT222 pAb (ATL-HPA054586 w/enhanced validation)
Datasheet Anti KRT222 pAb (ATL-HPA054586 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT222 pAb (ATL-HPA054586 w/enhanced validation)