Anti KRIT1 pAb (ATL-HPA049606)

Atlas Antibodies

SKU:
ATL-HPA049606-25
  • Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in blood vessels.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: KRIT1, ankyrin repeat containing
Gene Name: KRIT1
Alternative Gene Name: CAM, CCM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000600: 95%, ENSRNOG00000007937: 97%
Entrez Gene ID: 889
Uniprot ID: O00522
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLQLKPYHKPLQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEARYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIV
Gene Sequence SLQLKPYHKPLQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEARYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIV
Gene ID - Mouse ENSMUSG00000000600
Gene ID - Rat ENSRNOG00000007937
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KRIT1 pAb (ATL-HPA049606)
Datasheet Anti KRIT1 pAb (ATL-HPA049606) Datasheet (External Link)
Vendor Page Anti KRIT1 pAb (ATL-HPA049606) at Atlas Antibodies

Documents & Links for Anti KRIT1 pAb (ATL-HPA049606)
Datasheet Anti KRIT1 pAb (ATL-HPA049606) Datasheet (External Link)
Vendor Page Anti KRIT1 pAb (ATL-HPA049606)