Anti KRBOX4 pAb (ATL-HPA065295)

Atlas Antibodies

SKU: ATL-HPA065295-25

• 

Protein Description: KRAB box domain containing 4
Gene Name: KRBOX4
Alternative Gene Name: FLJ20344, ZNF673
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055775: 36%, ENSRNOG00000050042: 36%
Entrez Gene ID: 55634
Uniprot ID: Q5JUW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDEQIDHYKESQDKLPWQAAFIGKETLKDESGQ
• Gene Sequence: VDEQIDHYKESQDKLPWQAAFIGKETLKDESGQ
• Gene ID - Mouse: ENSMUSG00000055775
• Gene ID - Rat: ENSRNOG00000050042
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.