Protein Description: KRAB box domain containing 4
Gene Name: KRBOX4
Alternative Gene Name: FLJ20344, ZNF673
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055775: 36%, ENSRNOG00000050042: 36%
Entrez Gene ID: 55634
Uniprot ID: Q5JUW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KRBOX4
Alternative Gene Name: FLJ20344, ZNF673
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055775: 36%, ENSRNOG00000050042: 36%
Entrez Gene ID: 55634
Uniprot ID: Q5JUW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VDEQIDHYKESQDKLPWQAAFIGKETLKDESGQ |
| Documents & Links for Anti KRBOX4 pAb (ATL-HPA065295) | |
| Datasheet | Anti KRBOX4 pAb (ATL-HPA065295) Datasheet (External Link) |
| Vendor Page | Anti KRBOX4 pAb (ATL-HPA065295) at Atlas |
| Documents & Links for Anti KRBOX4 pAb (ATL-HPA065295) | |
| Datasheet | Anti KRBOX4 pAb (ATL-HPA065295) Datasheet (External Link) |
| Vendor Page | Anti KRBOX4 pAb (ATL-HPA065295) |