Anti KRBOX1 pAb (ATL-HPA046901)

Atlas Antibodies

SKU:
ATL-HPA046901-25
  • Immunofluorescent staining of human cell line BJ shows localization to nucleoplasm & the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: KRAB box domain containing 1
Gene Name: KRBOX1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034387: 28%, ENSRNOG00000002272: 25%
Entrez Gene ID: 100506243
Uniprot ID: C9JBD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YEAVAFVVPPTSKPALVSHLEQGKESCFTQPQGVLSRNDWRAGWIGYLELRRYTYLAKAVLRRIVSKIFRNRQCWEDR
Gene Sequence YEAVAFVVPPTSKPALVSHLEQGKESCFTQPQGVLSRNDWRAGWIGYLELRRYTYLAKAVLRRIVSKIFRNRQCWEDR
Gene ID - Mouse ENSMUSG00000034387
Gene ID - Rat ENSRNOG00000002272
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KRBOX1 pAb (ATL-HPA046901)
Datasheet Anti KRBOX1 pAb (ATL-HPA046901) Datasheet (External Link)
Vendor Page Anti KRBOX1 pAb (ATL-HPA046901) at Atlas Antibodies

Documents & Links for Anti KRBOX1 pAb (ATL-HPA046901)
Datasheet Anti KRBOX1 pAb (ATL-HPA046901) Datasheet (External Link)
Vendor Page Anti KRBOX1 pAb (ATL-HPA046901)