Anti KRAS pAb (ATL-HPA049830)
Atlas Antibodies
- SKU:
- ATL-HPA049830-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: KRAS
Alternative Gene Name: KRAS1, KRAS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030265: 100%, ENSRNOG00000009338: 100%
Entrez Gene ID: 3845
Uniprot ID: P01116
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV |
| Gene Sequence | EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV |
| Gene ID - Mouse | ENSMUSG00000030265 |
| Gene ID - Rat | ENSRNOG00000009338 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KRAS pAb (ATL-HPA049830) | |
| Datasheet | Anti KRAS pAb (ATL-HPA049830) Datasheet (External Link) |
| Vendor Page | Anti KRAS pAb (ATL-HPA049830) at Atlas Antibodies |
| Documents & Links for Anti KRAS pAb (ATL-HPA049830) | |
| Datasheet | Anti KRAS pAb (ATL-HPA049830) Datasheet (External Link) |
| Vendor Page | Anti KRAS pAb (ATL-HPA049830) |
| Citations for Anti KRAS pAb (ATL-HPA049830) – 1 Found |
| Herrera-Pulido, Jehison Alirio; Guerrero, Orlando Ricaurte; Forero, Jinneth Acosta; Moreno-Acosta, Pablo; Romero-Rojas, Alfredo; Sanabria, Carolina; Hernández, Gustavo; Serrano, Martha Lucía. KRAS Promoter Methylation Status and miR-18a-3p and miR-143 Expression in Patients With Wild-type KRAS Gene in Colorectal Cancer. Cancer Diagnosis & Prognosis. 2022;2(5):576-584. PubMed |