Anti KPNA1 pAb (ATL-HPA053627)

Atlas Antibodies

SKU: ATL-HPA053627-25

• 
• 
• 

Protein Description: karyopherin alpha 1 (importin alpha 5)
Gene Name: KPNA1
Alternative Gene Name: IPOA5, NPI-1, RCH2, SRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022905: 90%, ENSRNOG00000051711: 94%
Entrez Gene ID: 3836
Uniprot ID: P52294
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEMAPGGVITSDMIEMIFSKSPEQQLSATQK
• Gene Sequence: MEMAPGGVITSDMIEMIFSKSPEQQLSATQK
• Gene ID - Mouse: ENSMUSG00000022905
• Gene ID - Rat: ENSRNOG00000051711
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.