Anti KNDC1 pAb (ATL-HPA056143)

Atlas Antibodies

SKU:
ATL-HPA056143-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: kinase non-catalytic C-lobe domain containing 1
Gene Name: KNDC1
Alternative Gene Name: bB439H18.3, C10orf23, FLJ25027, KIAA1768, RASGEF2, v-KIND, Very-KIND
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066129: 89%, ENSRNOG00000027240: 89%
Entrez Gene ID: 85442
Uniprot ID: Q76NI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERLVTEKASVYCVAAVLWTAAKFSVPRNHKLALPRRLKTLLLDMARRSAPERPSAAEAIKVCGSYLLQRGMDSRKILAHLRASICQVYQ
Gene Sequence ERLVTEKASVYCVAAVLWTAAKFSVPRNHKLALPRRLKTLLLDMARRSAPERPSAAEAIKVCGSYLLQRGMDSRKILAHLRASICQVYQ
Gene ID - Mouse ENSMUSG00000066129
Gene ID - Rat ENSRNOG00000027240
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KNDC1 pAb (ATL-HPA056143)
Datasheet Anti KNDC1 pAb (ATL-HPA056143) Datasheet (External Link)
Vendor Page Anti KNDC1 pAb (ATL-HPA056143) at Atlas Antibodies

Documents & Links for Anti KNDC1 pAb (ATL-HPA056143)
Datasheet Anti KNDC1 pAb (ATL-HPA056143) Datasheet (External Link)
Vendor Page Anti KNDC1 pAb (ATL-HPA056143)