Anti KMO pAb (ATL-HPA056942)

Atlas Antibodies

SKU: ATL-HPA056942-25

• 

Protein Description: kynurenine 3-monooxygenase (kynurenine 3-hydroxylase)
Gene Name: KMO
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039783: 83%, ENSRNOG00000003709: 81%
Entrez Gene ID: 8564
Uniprot ID: O15229
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAI
• Gene Sequence: IALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAI
• Gene ID - Mouse: ENSMUSG00000039783
• Gene ID - Rat: ENSRNOG00000003709
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KMO pAb (ATL-HPA056942) – 1 Found

Hornigold, Nick; Dunn, Karen R; Craven, Rachel A; Zougman, Alexandre; Trainor, Sebastian; Shreeve, Rebecca; Brown, Joanne; Sewell, Helen; Shires, Michael; Knowles, Margaret; Fukuwatari, Tsutomu; Maher, Eamonn R; Burns, Julie; Bhattarai, Selina; Menon, Mini; Brazma, Alvis; Scelo, Ghislaine; Feulner, Lara; Riazalhosseini, Yasser; Lathrop, Mark; Harris, Adrian; Selby, Peter J; Banks, Rosamonde E; Vasudev, Naveen S. Dysregulation at multiple points of the kynurenine pathway is a ubiquitous feature of renal cancer: implications for tumour immune evasion. British Journal Of Cancer. 2020;123(1):137-147.