Anti KLRF1 pAb (ATL-HPA054038)

Atlas Antibodies

SKU: ATL-HPA054038-25

• 

Protein Description: killer cell lectin like receptor F1
Gene Name: KLRF1
Alternative Gene Name: CLEC5C, NKp80
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071158: 32%, ENSRNOG00000014975: 27%
Entrez Gene ID: 51348
Uniprot ID: Q9NZS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLER
• Gene Sequence: GSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLER
• Gene ID - Mouse: ENSMUSG00000071158
• Gene ID - Rat: ENSRNOG00000014975
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.