Anti KLK4 pAb (ATL-HPA051839 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051839-25

• 

Protein Description: kallikrein-related peptidase 4
Gene Name: KLK4
Alternative Gene Name: EMSP, EMSP1, KLK-L1, PRSS17, PSTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006948: 68%, ENSRNOG00000018864: 68%
Entrez Gene ID: 9622
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TIRSISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYH
• Gene Sequence: TIRSISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYH
• Gene ID - Mouse: ENSMUSG00000006948
• Gene ID - Rat: ENSRNOG00000018864
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.