Anti KLHL33 pAb (ATL-HPA049985 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049985-25

• 

Protein Description: kelch like family member 33
Gene Name: KLHL33
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090799: 75%, ENSRNOG00000042516: 73%
Entrez Gene ID: 123103
Uniprot ID: A6NCF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLTFAYEGVLGPASQGDVLAAAEALGAPRVKAAAQQTCERAGNAGEDVKKPSQAEELRENLRGIELLYREGVGCDLKLE
• Gene Sequence: VLTFAYEGVLGPASQGDVLAAAEALGAPRVKAAAQQTCERAGNAGEDVKKPSQAEELRENLRGIELLYREGVGCDLKLE
• Gene ID - Mouse: ENSMUSG00000090799
• Gene ID - Rat: ENSRNOG00000042516
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.