Anti KLHL29 pAb (ATL-HPA057379)

Atlas Antibodies

SKU:
ATL-HPA057379-100
  • Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol & mitochondria.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: kelch-like family member 29
Gene Name: KLHL29
Alternative Gene Name: KBTBD9, KIAA1921
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020627: 100%, ENSRNOG00000005371: 100%
Entrez Gene ID: 114818
Uniprot ID: Q96CT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVAEVIVLVGGRQMVGMTQRSLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSGGMESGVTLADVWCYMSLLDNWNLVSRM
Gene Sequence GVAEVIVLVGGRQMVGMTQRSLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSGGMESGVTLADVWCYMSLLDNWNLVSRM
Gene ID - Mouse ENSMUSG00000020627
Gene ID - Rat ENSRNOG00000005371
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KLHL29 pAb (ATL-HPA057379)
Datasheet Anti KLHL29 pAb (ATL-HPA057379) Datasheet (External Link)
Vendor Page Anti KLHL29 pAb (ATL-HPA057379) at Atlas Antibodies

Documents & Links for Anti KLHL29 pAb (ATL-HPA057379)
Datasheet Anti KLHL29 pAb (ATL-HPA057379) Datasheet (External Link)
Vendor Page Anti KLHL29 pAb (ATL-HPA057379)