Anti KLHL29 pAb (ATL-HPA049057)

Atlas Antibodies

SKU:
ATL-HPA049057-100
  • Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in cells of seminiferus ducts.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: kelch-like family member 29
Gene Name: KLHL29
Alternative Gene Name: KBTBD9, KIAA1921
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020627: 98%, ENSRNOG00000005371: 98%
Entrez Gene ID: 114818
Uniprot ID: Q96CT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQEEILSISKDDFIAYVSNDSLNTKAEELVYETVIKWIKKDPATRTQYAAELLAVVRLPFIHPSYLLNVV
Gene Sequence SNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQEEILSISKDDFIAYVSNDSLNTKAEELVYETVIKWIKKDPATRTQYAAELLAVVRLPFIHPSYLLNVV
Gene ID - Mouse ENSMUSG00000020627
Gene ID - Rat ENSRNOG00000005371
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KLHL29 pAb (ATL-HPA049057)
Datasheet Anti KLHL29 pAb (ATL-HPA049057) Datasheet (External Link)
Vendor Page Anti KLHL29 pAb (ATL-HPA049057) at Atlas Antibodies

Documents & Links for Anti KLHL29 pAb (ATL-HPA049057)
Datasheet Anti KLHL29 pAb (ATL-HPA049057) Datasheet (External Link)
Vendor Page Anti KLHL29 pAb (ATL-HPA049057)