Anti KLHL24 pAb (ATL-HPA056337)

Atlas Antibodies

SKU:
ATL-HPA056337-25
  • Immunohistochemical staining of human Skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: kelch-like family member 24
Gene Name: KLHL24
Alternative Gene Name: DRE1, FLJ20059
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062901: 99%, ENSRNOG00000033372: 99%
Entrez Gene ID: 54800
Uniprot ID: Q6TFL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGHEFFDFSSGSSHAENILQIFNEFRDSRLFTDVIICVEG
Gene Sequence MVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGHEFFDFSSGSSHAENILQIFNEFRDSRLFTDVIICVEG
Gene ID - Mouse ENSMUSG00000062901
Gene ID - Rat ENSRNOG00000033372
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KLHL24 pAb (ATL-HPA056337)
Datasheet Anti KLHL24 pAb (ATL-HPA056337) Datasheet (External Link)
Vendor Page Anti KLHL24 pAb (ATL-HPA056337) at Atlas Antibodies

Documents & Links for Anti KLHL24 pAb (ATL-HPA056337)
Datasheet Anti KLHL24 pAb (ATL-HPA056337) Datasheet (External Link)
Vendor Page Anti KLHL24 pAb (ATL-HPA056337)