Anti KLF3 pAb (ATL-HPA049512)

Atlas Antibodies

SKU:
ATL-HPA049512-25
  • Immunohistochemical staining of human colorectal cancer shows strong nuclear positivity in tumor cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Western blot analysis in human cell line K562.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Kruppel-like factor 3 (basic)
Gene Name: KLF3
Alternative Gene Name: BKLF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029178: 96%, ENSRNOG00000002163: 99%
Entrez Gene ID: 51274
Uniprot ID: P57682
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SYEKPISQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKR
Gene Sequence SYEKPISQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKR
Gene ID - Mouse ENSMUSG00000029178
Gene ID - Rat ENSRNOG00000002163
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KLF3 pAb (ATL-HPA049512)
Datasheet Anti KLF3 pAb (ATL-HPA049512) Datasheet (External Link)
Vendor Page Anti KLF3 pAb (ATL-HPA049512) at Atlas Antibodies

Documents & Links for Anti KLF3 pAb (ATL-HPA049512)
Datasheet Anti KLF3 pAb (ATL-HPA049512) Datasheet (External Link)
Vendor Page Anti KLF3 pAb (ATL-HPA049512)