Anti KLC3 pAb (ATL-HPA052797)

Atlas Antibodies

SKU: ATL-HPA052797-25

• 

Protein Description: kinesin light chain 3
Gene Name: KLC3
Alternative Gene Name: KLC2L, KLCt, KNS2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040714: 91%, ENSRNOG00000018101: 89%
Entrez Gene ID: 147700
Uniprot ID: Q6P597
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQLRQYDPPAESQQSESPPRRDSLASLFPSEEEERKGPEAAGAA
• Gene Sequence: GQLRQYDPPAESQQSESPPRRDSLASLFPSEEEERKGPEAAGAA
• Gene ID - Mouse: ENSMUSG00000040714
• Gene ID - Rat: ENSRNOG00000018101
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.