Protein Description: KIT ligand
Gene Name: KITLG
Alternative Gene Name: FPH2, Kitl, KL-1, MGF, SCF, SF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019966: 90%, ENSRNOG00000005386: 90%
Entrez Gene ID: 4254
Uniprot ID: P21583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KITLG
Alternative Gene Name: FPH2, Kitl, KL-1, MGF, SCF, SF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019966: 90%, ENSRNOG00000005386: 90%
Entrez Gene ID: 4254
Uniprot ID: P21583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | YWKKRQPSLTRAVENIQINEEDNEISMLQEK |
Documents & Links for Anti KITLG pAb (ATL-HPA070395) | |
Datasheet | Anti KITLG pAb (ATL-HPA070395) Datasheet (External Link) |
Vendor Page | Anti KITLG pAb (ATL-HPA070395) at Atlas |
Documents & Links for Anti KITLG pAb (ATL-HPA070395) | |
Datasheet | Anti KITLG pAb (ATL-HPA070395) Datasheet (External Link) |
Vendor Page | Anti KITLG pAb (ATL-HPA070395) |