Anti KIRREL3 pAb (ATL-HPA056320 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA056320-25

• 

Protein Description: kin of IRRE like 3 (Drosophila)
Gene Name: KIRREL3
Alternative Gene Name: KIAA1867, KIRRE, NEPH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032036: 100%, ENSRNOG00000009772: 100%
Entrez Gene ID: 84623
Uniprot ID: Q8IZU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTGMSFTNIYSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSR
• Gene Sequence: PTGMSFTNIYSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSR
• Gene ID - Mouse: ENSMUSG00000032036
• Gene ID - Rat: ENSRNOG00000009772
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.