Anti KIR3DX1 pAb (ATL-HPA052110)

Atlas Antibodies

SKU:
ATL-HPA052110-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: killer cell immunoglobulin-like receptor, three domains, X1
Gene Name: KIR3DX1
Alternative Gene Name: FLJ00060, LENG12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078810: 43%, ENSRNOG00000047204: 42%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CVGIYKHASKWSAESNSLKIIVTGLFTKPSISAHPSSLVHAGARVSLRCHSELAFDEFILYKEGHIQHSQQLDQGME
Gene Sequence CVGIYKHASKWSAESNSLKIIVTGLFTKPSISAHPSSLVHAGARVSLRCHSELAFDEFILYKEGHIQHSQQLDQGME
Gene ID - Mouse ENSMUSG00000078810
Gene ID - Rat ENSRNOG00000047204
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KIR3DX1 pAb (ATL-HPA052110)
Datasheet Anti KIR3DX1 pAb (ATL-HPA052110) Datasheet (External Link)
Vendor Page Anti KIR3DX1 pAb (ATL-HPA052110) at Atlas Antibodies

Documents & Links for Anti KIR3DX1 pAb (ATL-HPA052110)
Datasheet Anti KIR3DX1 pAb (ATL-HPA052110) Datasheet (External Link)
Vendor Page Anti KIR3DX1 pAb (ATL-HPA052110)