Protein Description: kinesin family member 5A
Gene Name: KIF5A
Alternative Gene Name: D12S1889, MY050, NKHC, SPG10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074657: 98%, ENSRNOG00000005299: 100%
Entrez Gene ID: 3798
Uniprot ID: Q12840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIF5A
Alternative Gene Name: D12S1889, MY050, NKHC, SPG10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074657: 98%, ENSRNOG00000005299: 100%
Entrez Gene ID: 3798
Uniprot ID: Q12840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RLQEVSGHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFT |
Documents & Links for Anti KIF5A pAb (ATL-HPA073448) | |
Datasheet | Anti KIF5A pAb (ATL-HPA073448) Datasheet (External Link) |
Vendor Page | Anti KIF5A pAb (ATL-HPA073448) at Atlas |
Documents & Links for Anti KIF5A pAb (ATL-HPA073448) | |
Datasheet | Anti KIF5A pAb (ATL-HPA073448) Datasheet (External Link) |
Vendor Page | Anti KIF5A pAb (ATL-HPA073448) |