Anti KIF5A pAb (ATL-HPA073448)

Atlas Antibodies

SKU: ATL-HPA073448-25

• 

Protein Description: kinesin family member 5A
Gene Name: KIF5A
Alternative Gene Name: D12S1889, MY050, NKHC, SPG10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074657: 98%, ENSRNOG00000005299: 100%
Entrez Gene ID: 3798
Uniprot ID: Q12840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLQEVSGHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFT
• Gene Sequence: RLQEVSGHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFT
• Gene ID - Mouse: ENSMUSG00000074657
• Gene ID - Rat: ENSRNOG00000005299
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.