Anti KIF26A pAb (ATL-HPA060346)

Atlas Antibodies

SKU:
ATL-HPA060346-25
  • Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: kinesin family member 26A
Gene Name: KIF26A
Alternative Gene Name: DKFZP434N178, KIAA1236
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021294: 80%, ENSRNOG00000013661: 80%
Entrez Gene ID: 26153
Uniprot ID: Q9ULI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VAVADTVRECPPVAGPDGLSKAWGRGGVCTSALVTPTPGSVGGSTGPSAAASFFIRAMQKLSLASKRKKP
Gene Sequence VAVADTVRECPPVAGPDGLSKAWGRGGVCTSALVTPTPGSVGGSTGPSAAASFFIRAMQKLSLASKRKKP
Gene ID - Mouse ENSMUSG00000021294
Gene ID - Rat ENSRNOG00000013661
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KIF26A pAb (ATL-HPA060346)
Datasheet Anti KIF26A pAb (ATL-HPA060346) Datasheet (External Link)
Vendor Page Anti KIF26A pAb (ATL-HPA060346) at Atlas Antibodies

Documents & Links for Anti KIF26A pAb (ATL-HPA060346)
Datasheet Anti KIF26A pAb (ATL-HPA060346) Datasheet (External Link)
Vendor Page Anti KIF26A pAb (ATL-HPA060346)