Anti KIF22 pAb (ATL-HPA048213)

Atlas Antibodies

SKU:
ATL-HPA048213-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: kinesin family member 22
Gene Name: KIF22
Alternative Gene Name: Kid, KNSL4, OBP-1, OBP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030677: 83%, ENSRNOG00000020281: 81%
Entrez Gene ID: 3835
Uniprot ID: Q14807
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESF
Gene Sequence LEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESF
Gene ID - Mouse ENSMUSG00000030677
Gene ID - Rat ENSRNOG00000020281
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KIF22 pAb (ATL-HPA048213)
Datasheet Anti KIF22 pAb (ATL-HPA048213) Datasheet (External Link)
Vendor Page Anti KIF22 pAb (ATL-HPA048213) at Atlas Antibodies

Documents & Links for Anti KIF22 pAb (ATL-HPA048213)
Datasheet Anti KIF22 pAb (ATL-HPA048213) Datasheet (External Link)
Vendor Page Anti KIF22 pAb (ATL-HPA048213)



Citations for Anti KIF22 pAb (ATL-HPA048213) – 1 Found
Marquis, Carolyn; Fonseca, Cindy L; Queen, Katelyn A; Wood, Lisa; Vandal, Sarah E; Malaby, Heidi L H; Clayton, Joseph E; Stumpff, Jason. Chromosomally unstable tumor cells specifically require KIF18A for proliferation. Nature Communications. 2021;12(1):1213.  PubMed