Anti KIAA1841 pAb (ATL-HPA051240)

Atlas Antibodies

SKU:
ATL-HPA051240-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes while bile duct cells were negative.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: KIAA1841
Gene Name: KIAA1841
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042208: 78%, ENSRNOG00000054669: 78%
Entrez Gene ID: 84542
Uniprot ID: Q6NSI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PCCNQKVLRFDPTQLTKGCKVRDHMVTLRDQGEGGDLPSCPTARMLDDLHKYRDVIVVPFSKDTVSDVGVGLCDEKGIECDVLLEPNT
Gene Sequence PCCNQKVLRFDPTQLTKGCKVRDHMVTLRDQGEGGDLPSCPTARMLDDLHKYRDVIVVPFSKDTVSDVGVGLCDEKGIECDVLLEPNT
Gene ID - Mouse ENSMUSG00000042208
Gene ID - Rat ENSRNOG00000054669
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KIAA1841 pAb (ATL-HPA051240)
Datasheet Anti KIAA1841 pAb (ATL-HPA051240) Datasheet (External Link)
Vendor Page Anti KIAA1841 pAb (ATL-HPA051240) at Atlas Antibodies

Documents & Links for Anti KIAA1841 pAb (ATL-HPA051240)
Datasheet Anti KIAA1841 pAb (ATL-HPA051240) Datasheet (External Link)
Vendor Page Anti KIAA1841 pAb (ATL-HPA051240)