Anti KIAA1257 pAb (ATL-HPA048445)

Atlas Antibodies

SKU:
ATL-HPA048445-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line AF22 shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: KIAA1257
Gene Name: KIAA1257
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020982: 25%, ENSRNOG00000018719: 25%
Entrez Gene ID: 57501
Uniprot ID: Q9ULG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPISSITSFYQSTSECDVEEHLKAKARAQESDSDRPCSSIESSSEPASTFSSDVPHVVPCKFTISLAFPVNMGQKGKYASLIEKYKKHPKTDSSVTKMRR
Gene Sequence EPISSITSFYQSTSECDVEEHLKAKARAQESDSDRPCSSIESSSEPASTFSSDVPHVVPCKFTISLAFPVNMGQKGKYASLIEKYKKHPKTDSSVTKMRR
Gene ID - Mouse ENSMUSG00000020982
Gene ID - Rat ENSRNOG00000018719
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KIAA1257 pAb (ATL-HPA048445)
Datasheet Anti KIAA1257 pAb (ATL-HPA048445) Datasheet (External Link)
Vendor Page Anti KIAA1257 pAb (ATL-HPA048445) at Atlas Antibodies

Documents & Links for Anti KIAA1257 pAb (ATL-HPA048445)
Datasheet Anti KIAA1257 pAb (ATL-HPA048445) Datasheet (External Link)
Vendor Page Anti KIAA1257 pAb (ATL-HPA048445)