Anti KIAA1191 pAb (ATL-HPA048145)

Atlas Antibodies

SKU:
ATL-HPA048145-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic and nuclear positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: KIAA1191
Gene Name: KIAA1191
Alternative Gene Name: FLJ21022
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025871: 74%, ENSRNOG00000017133: 75%
Entrez Gene ID: 57179
Uniprot ID: Q96A73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVMEGKKQPPRAHNLKPRDLNVLTPTGF
Gene Sequence SGSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVMEGKKQPPRAHNLKPRDLNVLTPTGF
Gene ID - Mouse ENSMUSG00000025871
Gene ID - Rat ENSRNOG00000017133
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KIAA1191 pAb (ATL-HPA048145)
Datasheet Anti KIAA1191 pAb (ATL-HPA048145) Datasheet (External Link)
Vendor Page Anti KIAA1191 pAb (ATL-HPA048145) at Atlas Antibodies

Documents & Links for Anti KIAA1191 pAb (ATL-HPA048145)
Datasheet Anti KIAA1191 pAb (ATL-HPA048145) Datasheet (External Link)
Vendor Page Anti KIAA1191 pAb (ATL-HPA048145)