Protein Description: KIAA1161
Gene Name: KIAA1161
Alternative Gene Name: NET37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046312: 95%, ENSRNOG00000023208: 94%
Entrez Gene ID: 57462
Uniprot ID: Q6NSJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIAA1161
Alternative Gene Name: NET37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046312: 95%, ENSRNOG00000023208: 94%
Entrez Gene ID: 57462
Uniprot ID: Q6NSJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DSVPFHLGWNSTERSLRLQARYHDTPYKPPAGRAAAPELSYRVCVGSDVTSIHKYMVRRYFNKPSRVPAPEAFRDPIW |
Documents & Links for Anti KIAA1161 pAb (ATL-HPA067487) | |
Datasheet | Anti KIAA1161 pAb (ATL-HPA067487) Datasheet (External Link) |
Vendor Page | Anti KIAA1161 pAb (ATL-HPA067487) at Atlas |
Documents & Links for Anti KIAA1161 pAb (ATL-HPA067487) | |
Datasheet | Anti KIAA1161 pAb (ATL-HPA067487) Datasheet (External Link) |
Vendor Page | Anti KIAA1161 pAb (ATL-HPA067487) |